RC-TSM | 10mg

Original price was: $139.99.Current price is: $69.99.

53 in stock

Bulk Discount Quantity Price Per Vial
5 for 20% 5 - 9 $55.99
10 for 30% 10 - 19 $48.99
20 for 40% 20 - 49 $41.99
50 for 50% 50 + $35.00
Purchase & earn 70 points!

Disclaimer: All peptides are shipped as dry lyophilized powder for stability. RCHQ does not ship pre-mixed products. Once reconstituted with a suitable option such as our Reconstitution Solution, store refrigerated according to proper research handling standards.

SKU RC-TSM-10 Categories ,
Tesamorelin Label Verification Guide

Description

Tesamorelin Research Peptide

Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone, commonly referred to as GHRH. It is used in controlled laboratory research involving peptide-receptor interaction dynamics, endocrine signaling models, intracellular pathway analysis, and structure-function characterization.

ResearchChemHQ supplies Tesamorelin in lyophilized powder form to support stability during shipping, storage, and laboratory handling. Each batch is produced for research-use-only applications and may be supported by batch-specific documentation through the RCHQ COA Library.

Tesamorelin is intended strictly for laboratory, analytical, and scientific research use only. It is not intended for human or animal consumption, medical use, diagnostic use, therapeutic use, dietary supplement use, cosmetic use, or compounding.

Chemical Information

Product Name: Tesamorelin
Compound Class: Growth hormone-releasing hormone analog
Molecular Formula: C223H370N72O69S
Molecular Weight: 5195.9 g/mol
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Appearance: Lyophilized powder
Purity: Batch-specific purity reported on COA
Storage Form: Lyophilized powder
Molecular Structure: Refer to the batch-specific Certificate of Analysis for structural and analytical details.

Research Applications

Tesamorelin may be used in controlled laboratory research settings for applications such as:

  • GHRH receptor binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
  • Peptide-receptor interaction research in endocrine signaling models
  • Intracellular signaling cascade evaluation involving peptide ligands
  • Structure-function research of GHRH-derived peptide analogs
  • Peptide stability and degradation profiling in assay-based systems
  • Analytical evaluation of peptide sequence and structural characteristics

All research involving Tesamorelin should be conducted by qualified professionals using appropriate laboratory practices, documentation, and controlled research conditions.

Storage and Handling

Store lyophilized Tesamorelin according to proper laboratory storage practices.

  • Keep lyophilized material in a cool, dry environment
  • For long-term storage, maintain at -20°C / -4°F
  • Once reconstituted, store at 2–8°C / 36–46°F
  • Use promptly after reconstitution according to internal laboratory protocols
  • Maintain aseptic handling practices
  • Avoid repeated freeze-thaw cycles
  • Protect from unnecessary light, heat, and moisture exposure

Storage conditions may affect peptide stability, so researchers should follow appropriate handling standards for lyophilized peptides.

Quality and Testing

ResearchChemHQ is committed to transparency and research-grade quality standards. Tesamorelin batches may be supported by third-party analytical testing and batch-specific documentation.

Testing may include verification of key quality markers such as:

  • Purity
  • Compound identity
  • Quantity verification
  • Sterility
  • Endotoxin levels

Researchers can reference the corresponding Certificate of Analysis for batch-specific testing results.

Compliance Notice

Tesamorelin is sold strictly for research use only.

This product is not intended for human consumption, animal consumption, medical use, diagnostic use, therapeutic use, dietary supplement use, cosmetic use, or compounding.

This product has not been evaluated or approved by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws.

By purchasing this product, the buyer acknowledges and agrees that it will be used only for lawful laboratory, analytical, and scientific research purposes by qualified individuals or institutions.

1 review for RC-TSM | 10mg

  1. Ron F. (verified owner)

    Great

Only logged in customers who have purchased this product may leave a review.

Shopping Basket
ResearchChemHQ logo

Come Back Again

You must be over 21 years old to see this content

You are not old enough to view this content.

ResearchChemHQ logo

You must be at least 21 years old to enter this site.

By entering, you agree to our Terms & Conditions.

ResearchChemHQ logo

Come Back Again

You must be over 21 years old to see this content